CLUAP1 Rabbit Polyclonal Antibody

CAT#: TA333852

Rabbit Polyclonal Anti-CLUAP1 Antibody

Product Images

WB Suggested Anti-CLUAP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: ACHN cell lysateCLUAP1 is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CLUAP1 Antibody: synthetic peptide directed towards the C terminal of human CLUAP1. Synthetic peptide located within the following region: RIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: clusterin associated protein 1
• Database Link:
  NP_055856
  Entrez Gene 23059 Human
  UniProt ID Q96AJ1
• Background: CLUAP1 may play a role in cell proliferation or apoptosis.
• Synonyms: CFAP22; FAP22; IFT38
• Note: Immunogen sequence homology: Human: 100%; Zebrafish: 93%; Rat: 92%; Mouse: 92%; Yeast: 92%; Bovine: 86%; Goat: 85%; Pig: 79%; Horse: 79%