Upstream Binding Protein 1 (UBP1) Rabbit Polyclonal Antibody
Other products for "UBP1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-UBP1 Antibody: synthetic peptide directed towards the middle region of human UBP1. Synthetic peptide located within the following region: GASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKED |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 60 kDa |
Gene Name | upstream binding protein 1 (LBP-1a) |
Database Link | |
Background | UBP1 is an important SF1-independent transcriptional activator stimulating P450scc expression in human placental JEG-3 cells, whereas LBP-9 modulates the action of UBP1, exerting both positive and negative effects |
Synonyms | LBP-1a; LBP-1B; LBP1A; LBP1B |
Note | Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Mouse: 86%; Rabbit: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.