SLC25A24 Rabbit Polyclonal Antibody

CAT#: TA333875

Rabbit Polyclonal Anti-SLC25A24 Antibody

Product Images

WB Suggested Anti-SLC25A24 Antibody Titration: 2.5 ug/ml; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A24 Antibody: synthetic peptide directed towards the middle region of human SLC25A24. Synthetic peptide located within the following region: FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: solute carrier family 25 member 24
• Database Link:
  NP_037518
  Entrez Gene 29957 Human
  UniProt ID Q6NUK1
• Background: SLC25A24 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
• Synonyms: APC1; SCAMC-1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome