SOX15 Rabbit Polyclonal Antibody

CAT#: TA333905

Rabbit Polyclonal Anti-SOX15 Antibody

Product Images

WB Suggested Anti-SOX15 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SOX15 Antibody: synthetic peptide directed towards the middle region of human SOX15. Synthetic peptide located within the following region: SHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: SRY-box 15
• Database Link:
  NP_008873
  Entrez Gene 6665 Human
  UniProt ID O60248
• Background: SOX15 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The protein may act as a transcriptional regulator after forming a protein complex with other proteins. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.
• Synonyms: SOX20; SOX26; SOX27
• Note: Immunogen sequence homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rat: 92%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors