DP2 (TFDP2) Rabbit Polyclonal Antibody

CAT#: TA333923

Rabbit Polyclonal Anti-TFDP2 Antibody

Product Images

WB Suggested Anti-TFDP2 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysateTFDP2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TFDP2 Antibody: synthetic peptide directed towards the N terminal of human TFDP2. Synthetic peptide located within the following region: MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: transcription factor Dp-2
• Database Link:
  NP_006277
  Entrez Gene 7029 Human
  UniProt ID Q14188
• Background: The TFDP genes encode a family of transcription factors that can form heterodimers with E2F family proteins in vivo. The E2F-TFDP transcription factors are major regulators of genes that are required for the progression of S-phase, such as DHFR and DNA polymerase alpha, and they play a critical role in cell cycle regulation and differentiation.
• Synonyms: DP2
• Note: Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Cell cycle