SLC17A4 Rabbit Polyclonal Antibody

CAT#: TA333941

Rabbit Polyclonal Anti-SLC17A4 Antibody

Product Images

WB Suggested Anti-SLC17A4 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC17A4 Antibody: synthetic peptide directed towards the middle region of human SLC17A4. Synthetic peptide located within the following region: YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: solute carrier family 17 member 4
• Database Link:
  NP_005486
  Entrez Gene 10050 Human
  UniProt ID Q9Y2C5
• Background: As a Na/PO4 cotransporter, SLC17A4 may be important to the regulation of Li transport and its therapeutic effects.
• Synonyms: KAIA2138
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Bovine: 93%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane