SLC17A4 Rabbit Polyclonal Antibody
Other products for "SLC17A4"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC17A4 Antibody: synthetic peptide directed towards the middle region of human SLC17A4. Synthetic peptide located within the following region: YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 55 kDa |
Gene Name | solute carrier family 17 member 4 |
Database Link | |
Background | As a Na/PO4 cotransporter, SLC17A4 may be important to the regulation of Li transport and its therapeutic effects. |
Synonyms | KAIA2138 |
Note | Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Bovine: 93%; Pig: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.