EIF4E1B Rabbit Polyclonal Antibody

CAT#: TA334102

Rabbit Polyclonal Anti-EIF4E1B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "EIF4E1B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-EIF4E1B Antibody is: synthetic peptide directed towards the N-terminal region of Human EIF4E1B. Synthetic peptide located within the following region: EKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRWA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 27 kDa
Gene Name eukaryotic translation initiation factor 4E family member 1B
Background EIF4E1B recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structure.
Synonyms FLJ36951
Note Immunogen sequence homology: Human: 100%
Reference Data
Protein Pathways Insulin signaling pathway, mTOR signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.