SLC38A1 Rabbit Polyclonal Antibody

CAT#: TA334121

Rabbit Polyclonal Anti-SLC38A1 Antibody

Product Images

WB Suggested Anti-SLC38A1 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate;SLC38A1 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC38A1 Antibody: synthetic peptide directed towards the middle region of human SLC38A1. Synthetic peptide located within the following region: LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: solute carrier family 38 member 1
• Database Link:
  NP_001070952
  Entrez Gene 81539 Human
  UniProt ID Q9H2H9
• Background: Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.
• Synonyms: ATA1; NAT2; SAT1; SNAT1
• Note: Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Dog: 91%; Horse: 86%; Bovine: 85%

Reference Data

• Protein Families: Transmembrane