Claudin 8 (CLDN8) Rabbit Polyclonal Antibody

CAT#: TA334199

Rabbit Polyclonal Anti-CLDN8 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CLDN8"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CLDN8 antibody: synthetic peptide directed towards the C terminal of human CLDN8. Synthetic peptide located within the following region: IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name claudin 8
Background CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Synonyms HEL-S-79
Note Immunogen Sequence Homology: Human: 100%; Horse: 85%; Bovine: 85%; Rabbit: 85%; Dog: 77%; Pig: 77%; Rat: 77%
Reference Data
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.