Claudin 15 (CLDN15) Rabbit Polyclonal Antibody

CAT#: TA334208

Rabbit Polyclonal Anti-CLDN15 Antibody

Product Images

WB Suggested Anti-CLDN15 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the middle region of human CLDN15. Synthetic peptide located within the following region: LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: claudin 15
• Database Link:
  NP_055158
  Entrez Gene 24146 Human
  UniProt ID P56746
• Background: CLDN15 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
• Synonyms: FLJ42715; MGC19536
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 92%; Horse: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction