ZIC5 Rabbit Polyclonal Antibody

CAT#: TA334216

Rabbit Polyclonal Anti-ZIC5 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ZIC5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZIC5 antibody: synthetic peptide directed towards the N terminal of human ZIC5. Synthetic peptide located within the following region: MEPPLSKRNPPALRLADLATAQVQPLQNMTGFPALAGPPAHSQLRAAVAH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 66 kDa
Gene Name Zic family member 5
Background ZIon Channel5 is a member of the ZIon Channel family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to a gene encoding zinc finger protein of the cerebellum 2, a related family member on chromosome 13. This gene encodes a protein of unknown function.
Synonyms Drosophila); OTTHUMP00000040732; Zic family member 5 (odd-paired homolog; zinc family member 5 protein; zinc finger protein of the cerebellum 5
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 92%; Guinea pig: 86%; Zebrafish: 79%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.