HAND1 Rabbit Polyclonal Antibody

CAT#: TA334253

Rabbit Polyclonal Anti-HAND1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "HAND1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HAND1 antibody: synthetic peptide directed towards the N terminal of human HAND1. Synthetic peptide located within the following region: CHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 23 kDa
Gene Name heart and neural crest derivatives expressed 1
Background The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, it has been suggested that this transcription factor may be required for early trophoblast differentiation.
Synonyms bHLHa27; eHand; Hxt; Thing1
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Rabbit: 85%
Reference Data
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.