PARP3 Rabbit Polyclonal Antibody

CAT#: TA334263

Rabbit Polyclonal Anti-PARP3 Antibody

Product Images

WB Suggested Anti-PARP3 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Stomach

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PARP3 antibody: synthetic peptide directed towards the C terminal of human PARP3. Synthetic peptide located within the following region: LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: poly(ADP-ribose) polymerase family member 3
• Database Link:
  NP_005476
  Entrez Gene 10039 Human
  UniProt ID Q9Y6F1
• Background: PARP3 belongs to the PARP family. These enzymes modify nuclear proteins by poly-ADP-ribosylation, which is required for DNA repair, regulation of apoptosis, and maintenance of genomic stability. PARP3 is preferentially localized to the daughter centriole throughout the cell cycle. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: ADPRT3; ADPRTL2; ADPRTL3; ARTD3; IRT1; PADPRT-3
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 92%; Bovine: 92%; Dog: 91%; Pig: 85%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Base excision repair