MYSM1 Rabbit Polyclonal Antibody

CAT#: TA334332

Rabbit Polyclonal Anti-MYSM1 Antibody

Product Images

Host: Rabbit; Target Name: MYSM1; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYSM1 antibody is: synthetic peptide directed towards the C-terminal region of Human MYSM1. Synthetic peptide located within the following region: CLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEENC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 91 kDa
• Gene Name: Myb like, SWIRM and MPN domains 1
• Database Link:
  NP_001078956
  Entrez Gene 114803 Human
  UniProt ID Q5VVJ2
• Background: MYSM1 is a metalloprotease that specifically deubiquitinates monoubiquitinated histone H2A, a specific tag for epigenetic transcriptional repression, thereby acting as a coactivator. It preferentially deubiquitinates monoubiquitinated H2A in hyperacetylated nucleosomes. Deubiquitination of histone H2A leads to facilitate the phosphorylation and dissociation of histone H1 from the nucleosome. MYSM1 acts as a coactivator by participating in the initiation and elongation steps of androgen receptor (AR)-induced gene activation.
• Synonyms: 2A-DUB; 2ADUB
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rabbit: 77%

Reference Data

• Protein Families: Protease