ALDH16A1 Rabbit Polyclonal Antibody

CAT#: TA334397

Rabbit Polyclonal Anti-ALDH16A1 Antibody

Product Images

Host: Rabbit; Target Name: ALDH16A1; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALDH16A1 antibody is: synthetic peptide directed towards the N-terminal region of Human ALDH16A1. Synthetic peptide located within the following region: YGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSVPCQDPITGENL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: aldehyde dehydrogenase 16 family member A1
• Database Link:
  NP_699160
  Entrez Gene 126133 Human
  UniProt ID Q8IZ83
• Background: This gene encodes a member of the aldehyde dehydrogenase superfamily. The family members act on aldehyde substrates and use nicotinamide adenine dinucleotide phosphate (NADP) as a cofactor. This gene is conserved in chimpanzee, dog, cow, mouse, rat, and zebrafish. The protein encoded by this gene interacts with maspardin, a protein that when truncated is responsible for Mast syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: MGC10204
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Mouse: 92%; Bovine: 86%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome