VASH1 Rabbit Polyclonal Antibody

CAT#: TA334560

Rabbit Polyclonal Anti-VASH1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "VASH1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-VASH1 antibody: synthetic peptide directed towards the middle region of human VASH1. Synthetic peptide located within the following region: SVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 41 kDa
Gene Name vasohibin 1
Background VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Synonyms KIAA1036
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%
Reference Data
Protein Families Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.