SAPS1 (PPP6R1) Rabbit Polyclonal Antibody

CAT#: TA334565

Rabbit Polyclonal Anti-PPP6R1 Antibody

Product Images

WB Suggested Anti-PPP6R1 Antibody Titration: 0.2-1 ug/ml; Positive Control: RPMI 8226 cell lysatePPP6R1 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPP6R1 antibody: synthetic peptide directed towards the N terminal of human PPP6R1. Synthetic peptide located within the following region: MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 97 kDa
• Gene Name: protein phosphatase 6 regulatory subunit 1
• Database Link:
  NP_055746
  Entrez Gene 22870 Human
  UniProt ID Q9UPN7
• Background: Protein phosphatase regulatory subunits, such as SAPS1, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS1 is a regulatory subunit for the protein phosphatase-6 catalytic subunit (PPP6C; MIM 300141) (Stefansson and Brautigan, 2006 [PubMed 16769727]).
• Synonyms: KIAA1115; PP6R1; SAP190; SAPS1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%