glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Polyclonal Antibody

CAT#: TA334651

Rabbit Polyclonal Anti-G6pc Antibody

Product Images

G6pc Antibody - N-terminal region (TA334651) in Mouse Lung using Western Blot.

• 

  G6PC Antibody - N-terminal region (TA334651) in Mouse Testis using Western Blot.

• 

  G6PC Antibody - N-terminal region (TA334651) in Mouse Liver using Western Blot.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: glucose-6-phosphatase catalytic subunit
• Database Link:
  NP_000142
  Entrez Gene 14377 Mouse
  UniProt ID P35575
• Background: G6pc hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.
• Synonyms: G6PC1; G6PT; GSD1; GSD1a
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 86%; Horse: 86%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: Adipocytokine signaling pathway, Galactose metabolism, Glycolysis / Gluconeogenesis, Insulin signaling pathway, Metabolic pathways, Starch and sucrose metabolism