Carboxypeptidase B (CPB1) Rabbit Polyclonal Antibody

CAT#: TA334670

Rabbit Polyclonal Anti-CPB1 Antibody

Product Images

WB Suggested Anti-CPB1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CPB1 antibody: synthetic peptide directed towards the N terminal of human CPB1. Synthetic peptide located within the following region: SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: carboxypeptidase B1
• Database Link:
  NP_001862
  Entrez Gene 1360 Human
  UniProt ID P15086
• Background: The specific function of the protein remains unknown.Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marker for acute pancreatitis and dysfunction of pancreatic transplants. It is not elevated in pancreatic carcinoma.
• Synonyms: CPB; PASP; PCPB
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 85%; Bovine: 85%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein