KIF2B Rabbit Polyclonal Antibody

CAT#: TA334702

Rabbit Polyclonal Anti-KIF2B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "KIF2B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KIF2B antibody: synthetic peptide directed towards the middle region of human KIF2B. Synthetic peptide located within the following region: CVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 76 kDa
Gene Name kinesin family member 2B
Background KIF2B is the plus end-directed microtubule-dependent motor required for spindle assembly and chromosome movement. KIF2B has microtubule depolymerization activity.
Synonyms FLJ53902
Note Immunogen Sequence Homology: Human: 100%; Dog: 87%; Pig: 87%; Mouse: 87%; Guinea pig: 87%; Rat: 80%; Rabbit: 80%; Horse: 79%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.