KIF2B Rabbit Polyclonal Antibody

CAT#: TA334742

Rabbit Polyclonal Anti-KIF2B Antibody

Product Images

WB Suggested Anti-KIF2B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIF2B antibody: synthetic peptide directed towards the middle region of human KIF2B. Synthetic peptide located within the following region: DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: kinesin family member 2B
• Database Link:
  NP_115948
  Entrez Gene 84643 Human
  UniProt ID Q8N4N8
• Background: KIF2B is the plus end-directed microtubule-dependent motor required for spindle assembly and chromosome movement. KIF2B has microtubule depolymerization activity.
• Synonyms: FLJ53902
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome