SIAH1 Rabbit Polyclonal Antibody

CAT#: TA334774

Rabbit Polyclonal Anti-SIAH1 Antibody

Product Images

WB Suggested Anti-SIAH1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

• 

  Researcher: Peter Brand & Dr. Oliver Kramer, Institute for Biochemistry and Biophysics, Center for Molecular Biomedicine, Friedrich-Schiller University JenaApplication: Western blottingSpecies+tissue/cell type: Human embryonic kidney 293THow many ug�s o

• 

  Rabbit Anti-SIAH1 antibody; Paraffin Embedded Tissue: Human Heart cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SIAH1 antibody: synthetic peptide directed towards the N terminal of human SIAH1. Synthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: siah E3 ubiquitin protein ligase 1
• Database Link:
  NP_001006611
  Entrez Gene 6477 Human
  UniProt ID Q8IUQ4
• Background: SIAH1 is a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
• Synonyms: SIAH1A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: p53 signaling pathway, Ubiquitin mediated proteolysis, Wnt signaling pathway