TAS2R45 Rabbit Polyclonal Antibody

CAT#: TA334834

Rabbit Polyclonal Anti-TAS2R45 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TAS2R45"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TAS2R45 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R45. Synthetic peptide located within the following region: MLANLVPFTVTLISFLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKVLQT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 32 kDa
Gene Name taste 2 receptor member 45
Background TAS2R45 is a receptor that may play a role in the perception of bitterness and is gustducin-linked. It may play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5
Synonyms GPR59; T2R45; ZG24P
Note Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Pig: 83%; Guinea pig: 83%
Reference Data
Protein Pathways Taste transduction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.