HIP55 (DBNL) Rabbit Polyclonal Antibody

CAT#: TA334945

Rabbit Polyclonal Anti-DBNL Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "DBNL"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DBNL antibody: synthetic peptide directed towards the middle region of human DBNL. Synthetic peptide located within the following region: QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 48 kDa
Gene Name drebrin like
Background DBNL is an actin-binding adapter protein. DBNL may act as a common effector of antigen receptor-signaling pathways in leukocytes. Its association with dynamin suggests that it may also connect the actin cytoskeleton to endocytic function. DBNL acts as a key component of the immunological synapse that regulates T-cell activation by bridging TCRs and the actin cytoskeleton to gene activation and endocytic processes. Binds to F-actin but is not involved in actin.
Synonyms ABP1; HIP-55; HIP55; SH3P7
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 86%; Pig: 79%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.