ACADVL Rabbit Polyclonal Antibody

CAT#: TA334968

Rabbit Polyclonal Anti-ACADVL Antibody

Product Images

Lanes: 1: Normal controls Normal enzyme expression; 2: Normal controls Normal enzyme expression; 3: Positive mutants Defective enzyme expression; 4: Positive mutants Defective enzyme expression; 5: Positive mutants Defective enzyme expression; Primary Ant

• 

  2Hum. Fetal Muscle; Host: Rabbit; Target Name: NOP56; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  3Hum. Adult Placenta; Host: Rabbit; Target Name: SERPINA3; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-ACADVL Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysateACADVL is supported by BioGPS gene expression data to be expressed in HepG2

• 

  5Human Hela; Host: Rabbit; Target Name: EGFL8; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml; ACADVL is supported by BioGPS gene expression data to be expressed in HeLa

• 

  Rabbit Anti-ACADVL Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies of pinealocytes; Primary Antibody Concentration: 1: 100; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibod

Show all 6 images

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACADVL antibody: synthetic peptide directed towards the N terminal of human ACADVL. Synthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: acyl-CoA dehydrogenase, very long chain
• Database Link:
  NP_001029031
  Entrez Gene 37 Human
  UniProt ID P49748
• Background: ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Synonyms: ACAD6; LCACD; VLCAD
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Guinea pig: 93%; Rabbit: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Fatty acid metabolism, Metabolic pathways