HAGH Rabbit Polyclonal Antibody

CAT#: TA334983

Rabbit Polyclonal Anti-HAGH Antibody

Product Images

WB Suggested Anti-HAGH Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

• 

  Host: Rabbit; Target Name: HAGH; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: HAGH; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HAGH antibody: synthetic peptide directed towards the C terminal of human HAGH. Synthetic peptide located within the following region: STLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: hydroxyacylglutathione hydrolase
• Database Link:
  NP_001035517
  Entrez Gene 3029 Human
  UniProt ID Q16775
• Background: HAGH belongs to the metallo-beta-lactamase superfamily, glyoxalase II family. It is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.
• Synonyms: GLO2; GLX2; GLXII; HAGH1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Pyruvate metabolism