UBE4B Rabbit Polyclonal Antibody

CAT#: TA335000

Rabbit Polyclonal Anti-UBE4B Antibody

Product Images

WB Suggested Anti-UBE4B Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UBE4B antibody: synthetic peptide directed towards the N terminal of human UBE4B. Synthetic peptide located within the following region: SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 146 kDa
• Gene Name: ubiquitination factor E4B
• Database Link:
  NP_001099032
  Entrez Gene 10277 Human
  UniProt ID O95155
• Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Synonyms: E4; HDNB1; UBOX3; UFD2; UFD2A
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 79%; Pig: 79%

Reference Data

• Protein Pathways: Ubiquitin mediated proteolysis