A RAF (ARAF) Rabbit Polyclonal Antibody

CAT#: TA335018

Rabbit Polyclonal Anti-ARAF Antibody

Product Images

WB Suggested Anti-ARAF Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARAF antibody: synthetic peptide directed towards the middle region of human ARAF. Synthetic peptide located within the following region: PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: A-Raf proto-oncogene, serine/threonine kinase
• Database Link:
  NP_001645
  Entrez Gene 369 Human
  UniProt ID P10398
• Background: ARAF belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily. It contains 1 phorbol-ester/DAG-type zinc finger, 1 protein kinase domain, and 1 RBD (Ras-binding) domain. ARAF is involved in the transduction of mitogenic signals from the cell membrane to the nucleus.
• Synonyms: A-RAF; ARAF1; PKS2; RAFA1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Acute myeloid leukemia, Bladder cancer, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Glioma, Insulin signaling pathway, Long-term depression, Long-term potentiation, Melanoma, Natural killer cell mediated cytotoxicity, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, Vascular smooth muscle contraction