FAU Rabbit Polyclonal Antibody

CAT#: TA335022

Rabbit Polyclonal Anti-FAU Antibody

Product Images

WB Suggested Anti-FAU Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysateFAU is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Host: Rabbit; Target Name: FAU; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml; FAU is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Host: Rabbit; Target Name: FAU; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml; FAU is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAU antibody: synthetic peptide directed towards the middle region of human FAU. Synthetic peptide located within the following region: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
• Database Link:
  NP_001988
  Entrez Gene 2197 Human
  UniProt ID P35544
• Background: FAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome.This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: asr1; FAU1; Fub1; Fubi; MNSFbeta; RPS30; S30
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Ribosome