LYN Rabbit Polyclonal Antibody

CAT#: TA335063

Rabbit Polyclonal Anti-LYN Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LYN antibody: synthetic peptide directed towards the N terminal of human LYN. Synthetic peptide located within the following region: DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 58 kDa
Gene Name LYN proto-oncogene, Src family tyrosine kinase
Background LYN down regulates expression of stem cell growth factor receptor (KIT).LYN acts as an effector of EpoR (erythropoietin receptor) in controlling KIT expression and may play a central role in erythroid differentiation during the switch between proliferation and maturation.LYN acts as a positive regulator of cell movement while negatively regulating adhesion to stromal cells by inhibiting the ICAM-1-binding activity of beta-2 integrins. LYN acts as the mediator that relays suppressing signals from the chemokine receptor CXCR4 to beta-2 integrin LFA-1 in hematopoietic precursors. Involved in induction of stress-activated protein kinase (SAPK), but not ERK or p38 MAPK, in response to genotoxic agents.LYN induces SAPK by a MKK7- and MEKK1-dependent mechanism. The LYN -> MEKK1 -> MKK7 -> SAPK pathway is functional in the induction of apoptosis by genotoxic agents.
Synonyms JTK8; p53Lyn; p56Lyn
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome, Protein Kinase
Protein Pathways B cell receptor signaling pathway, Chemokine signaling pathway, Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Long-term depression

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.