ARHGAP1 Rabbit Polyclonal Antibody

CAT#: TA335074

Rabbit Polyclonal Anti-ARHGAP1 Antibody

Product Images

WB Suggested Anti-ARHGAP1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARHGAP1 antibody: synthetic peptide directed towards the N terminal of human ARHGAP1. Synthetic peptide located within the following region: MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: Rho GTPase activating protein 1
• Database Link:
  NP_004299
  Entrez Gene 392 Human
  UniProt ID Q07960
• Background: ARHGAP1 is a GTPase activator for the Rho, Rac and Cdc42 proteins, converting them to the putatively inactive GDP-bound state. Cdc42 seems to be the preferred substrate.
• Synonyms: CDC42GAP; p50rhoGAP; RHOGAP; RHOGAP1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Rabbit: 86%