ARF4 Rabbit Polyclonal Antibody

CAT#: TA335123

Rabbit polyclonal Anti-Arf4 Antibody

Product Images

WB Suggested Anti-Arf4 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Arf4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: ADP ribosylation factor 4
• Database Link:
  NP_001651
  Entrez Gene 11843 Mouse
  UniProt ID P18085
• Background: Arf4 is an GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. It is Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
• Synonyms: ARF2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Yeast: 100%; Zebrafish: 100%