XPB (ERCC3) Rabbit Polyclonal Antibody

CAT#: TA335162

Rabbit Polyclonal Anti-ERCC3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ERCC3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ERCC3 antibody: synthetic peptide directed towards the N terminal of human ERCC3. Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 89 kDa
Gene Name ERCC excision repair 3, TFIIH core complex helicase subunit
Background ERCC3 is an ATP-dependent DNA helicase that functions in nucleotide excision repair and complements xeroderma pigmentosum group B mutations. It also is the 89 kDa subunit of basal transcription factor 2 (TFIIH) and thus functions in class II transcription.
Synonyms BTF2; GTF2H; RAD25; TFIIH; TTD2; XPB
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Yeast: 90%; Dog: 86%; Bovine: 86%; Rat: 79%; Rabbit: 79%; Zebrafish: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Nucleotide excision repair

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.