XPB (ERCC3) Rabbit Polyclonal Antibody

CAT#: TA335162

Rabbit Polyclonal Anti-ERCC3 Antibody

Product Images

WB Suggested Anti-ERCC3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HCT15 cell lysateERCC3 is supported by BioGPS gene expression data to be expressed in HCT15

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERCC3 antibody: synthetic peptide directed towards the N terminal of human ERCC3. Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 89 kDa
• Gene Name: ERCC excision repair 3, TFIIH core complex helicase subunit
• Database Link:
  NP_000113
  Entrez Gene 2071 Human
  UniProt ID P19447
• Background: ERCC3 is an ATP-dependent DNA helicase that functions in nucleotide excision repair and complements xeroderma pigmentosum group B mutations. It also is the 89 kDa subunit of basal transcription factor 2 (TFIIH) and thus functions in class II transcription.
• Synonyms: BTF2; GTF2H; RAD25; TFIIH; TTD2; XPB
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Yeast: 90%; Dog: 86%; Bovine: 86%; Rat: 79%; Rabbit: 79%; Zebrafish: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Nucleotide excision repair