MITF Rabbit Polyclonal Antibody

CAT#: TA335168

Rabbit Polyclonal Anti-MITF Antibody

Product Images

WB Suggested Anti-MITF Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MITF antibody: synthetic peptide directed towards the N terminal of human MITF. Synthetic peptide located within the following region: THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: melanogenesis associated transcription factor
• Database Link:
  NP_000239
  Entrez Gene 17342 MouseEntrez Gene 4286 Human
  UniProt ID O75030
• Background: MITF is a transcription factor that contains both basic helix-loop-helix and leucine zipper structural features. It regulates the differentiation and development of melanocytes retinal pigment epithelium and is also responsible for pigment cell-specific transcription of the melanogenesis enzyme genes. Heterozygous mutations in the this gene cause auditory-pigmentary syndromes, such as Waardenburg syndrome type 2 and Tietz syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: bHLHe32; CMM8; MI; WS2; WS2A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Melanogenesis, Melanoma, Pathways in cancer