GTF2H4 Rabbit Polyclonal Antibody

CAT#: TA335198

Rabbit Polyclonal Anti-GTF2H4 Antibody

Product Images

WB Suggested Anti-GTF2H4 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: general transcription factor IIH subunit 4
• Database Link:
  NP_001508
  Entrez Gene 2968 Human
  UniProt ID Q92759
• Background: GTF2H4 belongs to the TFB2 family. It is a component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.
• Synonyms: P52; TFB2; TFIIH
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Goat: 93%; Bovine: 93%; Dog: 87%; Guinea pig: 87%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Basal transcription factors, Nucleotide excision repair