TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody

CAT#: TA335216

Rabbit Polyclonal Anti-GTF2E2 Antibody

Product Images

WB Suggested Anti-GTF2E2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2. Synthetic peptide located within the following region: MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: general transcription factor IIE subunit 2
• Database Link:
  NP_002086
  Entrez Gene 2961 Human
  UniProt ID P29084
• Background: GTF2E2 recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.
• Synonyms: FE; TF2E2; TFIIE-B
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rat: 86%; Goat: 86%; Bovine: 86%; Pig: 79%; Guinea pig: 79%; Mouse: 77%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Basal transcription factors