delta Sarcoglycan (SGCD) Rabbit Polyclonal Antibody

CAT#: TA335222

Rabbit Polyclonal Anti-Sgcd Antibody

Product Images

WB Suggested Anti-Sgcd Antibody Titration: 1.0ug/mL; Positive Control: Mouse Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Sgcd antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FVLLLMILILVNLAMTIWILKVMNFTIDGMGNLRITEKGLKLEGDSEFLQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: sarcoglycan delta
• Database Link:
  NP_000328
  Entrez Gene 24052 Mouse
  UniProt ID Q92629
• Background: Sgcd is a component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.
• Synonyms: 35DAG; CMD1L; DAGD; SG-delta; SGCDP; SGD
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 93%; Horse: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis