TGFBI Rabbit Polyclonal Antibody

CAT#: TA335225

Rabbit Polyclonal Anti-TGFBI Antibody

Product Images

WB Suggested Anti-TGFBI Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: TGFBI; Sample Tissue: Jurkat; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 2.5 ug/mL; Peptide Concentration: 2.0 ug/mL; Lysate Quantity: 25 ug/lane; Gel Concentration: 12

• 

  Species, Tissue/Cell Type: Human Cornea tissue (epithelium and stroma); Primary used and dilution: 1: 400

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TGFBI antibody: synthetic peptide directed towards the C terminal of human TGFBI. Synthetic peptide located within the following region: LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: transforming growth factor beta induced
• Database Link:
  NP_000349
  Entrez Gene 7045 Human
  UniProt ID Q15582
• Background: TGFBI Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation.
• Synonyms: BIGH3; CDB1; CDG2; CDGG1; CSD; CSD1; CSD2; CSD3; EBMD; LCD1
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane