GGCX Rabbit Polyclonal Antibody

CAT#: TA335260

Rabbit Polyclonal Anti-GGCX Antibody

Product Images

WB Suggested Anti-GGCX Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: MCF7 cell lysate.GGCX is strongly supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: GGCX; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml.GGCX is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Rabbit Anti-GGCX Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, strong signal, wide tissue distribution; Primary Antibody Concentration: 1: 100; Secondary Antibody: Donkey anti-Rabbit-Cy3

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GGCX antibody: synthetic peptide directed towards the middle region of human GGCX. Synthetic peptide located within the following region: FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 87 kDa
• Gene Name: gamma-glutamyl carboxylase
• Database Link:
  NP_000812
  Entrez Gene 2677 Human
  UniProt ID P38435
• Background: GGCX is an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency.Gamma-glutamyl carboxylase accomplishes the posttranslational modification required for the activity of all of the vitamin K-dependent proteins (Wu et al., 1991 [PubMed 1749935]). These include some of the blood coagulation and anticoagulation proteins as well as bone gamma-carboxyglutamic acid (Gla) protein (BGLAP; MIM 112260) and bone matrix protein (MGP; MIM 154870). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: VKCFD1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane