DGAT2L4 (AWAT2) Rabbit Polyclonal Antibody

CAT#: TA335288

Rabbit Polyclonal Anti-DGAT2L4 Antibody

Product Images

WB Suggested Anti-DGAT2L4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DGAT2L4 antibody: synthetic peptide directed towards the C terminal of human DGAT2L4. Synthetic peptide located within the following region: GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: acyl-CoA wax alcohol acyltransferase 2
• Database Link:
  NP_001002254
  Entrez Gene 158835 Human
  UniProt ID Q6E213
• Background: DGAT2L4 is acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. It has no activity using decyl alcohol and significantly prefers the C16 and C18 alcohols. DGAT2L4 may also have 2-acylglycerol O-acyltransferase (MGAT) and acyl-CoA:retinol acyltransferase (ARAT) activities, to catalyze the synthesis of diacylglycerols and retinyl esters, however this activity is unclear in vivo.
• Synonyms: ARAT; DC4; DGAT2L4; MFAT; WS
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycerolipid metabolism, Metabolic pathways, Retinol metabolism