LCLAT1 Rabbit Polyclonal Antibody

CAT#: TA335289

Rabbit Polyclonal Anti-LYCAT Antibody

Product Images

WB Suggested Anti-LYCAT Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 721_B cell lysate

• 

  Host: Rabbit; Target Name: LCLAT1; Sample Tissue: Human 721_B cell; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5.0 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Con

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: lysocardiolipin acyltransferase 1
• Database Link:
  NP_001002257
  Entrez Gene 253558 Human
  UniProt ID Q6UWP7
• Background: LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.
• Synonyms: 1AGPAT8; AGPAT8; ALCAT1; HSRG1849; LYCAT; UNQ1849
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Dog: 92%; Pig: 92%; Rat: 92%; Mouse: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Ether lipid metabolism, Glycerolipid metabolism, Glycerophospholipid metabolism, Limonene and pinene degradation, Metabolic pathways, Phenylalanine metabolism, Tyrosine metabolism