IMPDH1 Rabbit Polyclonal Antibody

CAT#: TA335348

Rabbit Polyclonal Anti-IMPDH1 Antibody

Product Images

WB Suggested Anti-IMPDH1 Antibody Titration: 1 ug/ml; Positive Control: Hela cell lysate. IMPDH1 is supported by BioGPS gene expression data to be expressed in HeLa

• 

  Immunohistochemistry with Human Colon lysate tissue at an antibody concentration of 5.0 ug/ml using anti-IMPDH1 antibody

• 

  Human Pancreas

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IMPDH1 Antibody: synthetic peptide directed towards the middle region of human IMPDH1. Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: IMP (inosine 5'-monophosphate) dehydrogenase 1
• Database Link:
  NP_899066
  Entrez Gene 3614 Human
  UniProt ID P20839
• Background: IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).
• Synonyms: IMPD; IMPD1; IMPDH-I; LCA11; RP10; sWSS2608
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism