IFT122 Rabbit Polyclonal Antibody

CAT#: TA335415

Rabbit Polyclonal Anti-IFT122 Antibody

Product Images

Sample Type: 1. Human 293FT cell line (15ug); 2. Murine IMCD3 cell line (15ug); 3. Human RPE cell line (15ug); 4. Bovine retina lysate cleared at 100, 000Xg for 2 hours (15ug); 5. Mouse Brain Lysate (15ug); Primary Dilution: 1: 1000; Secondary Anditbody: goat anti-rabbit HRP; Scondary Dilution: 1: 10, 000; Image Submitted By: Gerald Liew; Stanford University

• 

  WB Suggested Anti-IFT122 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IFT122 Antibody: synthetic peptide directed towards the C terminal of human IFT122. Synthetic peptide located within the following region: QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 129 kDa
• Gene Name: intraflagellar transport 122
• Database Link:
  NP_443716
  Entrez Gene 55764 Human
  UniProt ID Q9HBG6
• Background: IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. IFT122 contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Synonyms: CED; CED1; SPG; WDR10; WDR10p; WDR140
• Note: Immunogen Sequence Homology: Human: 100%