B3GALNT1 Rabbit Polyclonal Antibody

CAT#: TA335426

Rabbit Polyclonal Anti-B3galnt1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "B3GALNT1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-B3galnt1 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FTGYPLIENYSYRGFFHKNHISYQEYPFKVFPPYCSGLGYIMSGDLVPKI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)
Background B3galnt1 transfers N-acetylgalactosamine onto globotriaosylceramide.
Synonyms B3GALT3; beta3Gal-T3; galT3; Gb4Cer; GLCT3; GLOB; P; P1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Transmembrane
Protein Pathways Glycosphingolipid biosynthesis - globo series, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.