MIER1 Rabbit Polyclonal Antibody

CAT#: TA335495

Rabbit Polyclonal Anti-MIER1 Antibody

Product Images

WB Suggested Anti-MIER1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MIER1 Antibody: synthetic peptide directed towards the middle region of human MIER1. Synthetic peptide located within the following region: RRTGDEKGVEAIPEGSHIKDNEQALYELVKCNFDTEEALRRLRF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: MIER1 transcriptional regulator
• Database Link:
  NP_065999
  Entrez Gene 57708 Human
  UniProt ID Q8N108
• Background: The association of hMI-ER1 with Sp1 represents a novel mechanism for the negative regulation of Sp1 target promoters. Results demonstrate that alternate use of a facultative intron regulates the subcellular localization of hMI-ER1 proteins and this may have important implications for hMI-ER1 function in the regulation of transcription. Repressor activity is due to interaction and recruitment of a trichostatin A-sensitive histone deacetylase 1 (HDAC1).
• Synonyms: ER1; MI-ER1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%