C1orf103 (LRIF1) Rabbit Polyclonal Antibody

CAT#: TA335519

Rabbit Polyclonal Anti-C1orf103 Antibody

Product Images

WB Suggested Anti-C1orf103 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate. LRIF1 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Host: Rabbit; Target Name: LRIF1; Sample Tissue: Human 721_B; Antibody Dilution: 1.0 ug/ml; LRIF1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C1orf103 Antibody: synthetic peptide directed towards the middle region of human C1orf103. Synthetic peptide located within the following region: SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 85 kDa
• Gene Name: ligand dependent nuclear receptor interacting factor 1
• Database Link:
  NP_060842
  Entrez Gene 55791 Human
  UniProt ID Q5T3J3
• Background: The specific function of this protein remains unknown.
• Synonyms: C1orf103; RIF1
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 91%; Horse: 91%; Mouse: 91%; Dog: 79%; Rabbit: 77%

Reference Data

• Protein Families: Stem cell - Pluripotency