EPLIN (LIMA1) Rabbit Polyclonal Antibody

CAT#: TA335562

Rabbit Polyclonal Anti-LIMA1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "LIMA1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-LIMA1 Antibody is: synthetic peptide directed towards the middle region of Human LIMA1. Synthetic peptide located within the following region: GVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSGSALEEGIKM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 85 kDa
Gene Name LIM domain and actin binding 1
Background This gene encodes a cytoskeleton-associated protein that inhibits actin filament depolymerization and cross-links filaments in bundles. It is downregulated in some cancer cell lines. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and expression of some of the variants maybe independently regulated.
Synonyms EPLIN; SREBP3
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Rabbit: 92%; Mouse: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.