COPZ1 Rabbit Polyclonal Antibody

CAT#: TA335569

Rabbit Polyclonal Anti-COPZ1 Antibody

Product Images

Host: Rabbit; Target Name: COPZ1; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-COPZ1 Antibody is: synthetic peptide directed towards the C-terminal region of Human COPZ1. Synthetic peptide located within the following region: DEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: coatomer protein complex subunit zeta 1
• Database Link:
  NP_057141
  Entrez Gene 22818 Human
  UniProt ID P61923
• Background: This gene encodes a subunit of the cytoplasmic coatamer protein complex, which is involved in autophagy and intracellular protein trafficking. The coatomer protein complex is comprised of seven subunits and functions as the coat protein of coat protein complex (COP)I-vesicles. Alternative splicing results in multiple transcript variants.
• Synonyms: CGI-120; COPZ; HSPC181; zeta-COP; zeta1-COP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%