Germany
Japan
United Kingdom
China
SUV420h1 (KMT5B) Rabbit Polyclonal Antibody
Other products for "KMT5B"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | IHC, WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-SUV420H1 Antibody: synthetic peptide directed towards the middle region of human SUV420H1. Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 99 kDa |
| Gene Name | lysine methyltransferase 5B |
| Database Link | |
| Background | SUV420H1 is a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. |
| Synonyms | CGI-85; CGI85; SUV420H1 |
| Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Mouse: 91%; Dog: 86% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | Lysine degradation |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.