SUV420h1 (KMT5B) Rabbit Polyclonal Antibody

CAT#: TA335572

Rabbit Polyclonal Anti-SUV420H1 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "KMT5B"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution IHC, WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SUV420H1 Antibody: synthetic peptide directed towards the C terminal of human SUV420H1. Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 52 kDa
Gene Name lysine methyltransferase 5B
Background SUV420H1 is a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined.
Synonyms CGI-85; CGI85; SUV420H1
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Mouse: 91%; Dog: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Lysine degradation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.